DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and CDYL2

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:123 Identity:36/123 - (29%)
Similarity:58/123 - (47%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 AKGRGRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDM-FKIRWKKYGPKDDSWEPSKNLA-C 272
            |:.||.|:...:..     |.:..|||:|:|....|:|.. :.||||.||..:|:|||..:|. |
Human    23 AQPRGARSPRRRPL-----PSRVEEVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHC 82

  Fly   273 DALIEKF--------MRKQATQENVDVKELRES-----PKKTERLVDECYPRTNLHNR 317
            :..|::|        .|.::.:::...|.||:|     .|.:.|..|....:...|.|
Human    83 EEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 22/60 (37%)
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605 20/48 (42%)
crotonase-like 286..482 CDD:119339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.