DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx4

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_031651.2 Gene:Cbx4 / 12418 MGIID:1195985 Length:551 Species:Mus musculus


Alignment Length:99 Identity:23/99 - (23%)
Similarity:46/99 - (46%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKEL 294
            |..:.||.|......|....:.::|:.:.||.::|||.:|:....|:..|..::..::.:..::.
Mouse     8 EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKR 72

  Fly   295 RESPKKTERLVDECYPRTNLHNRIERSSKRSSAK 328
            ...||.....|.....|:|:...::.||..:.||
Mouse    73 GPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 13/50 (26%)
Cbx4NP_031651.2 CHROMO 10..62 CDD:214605 13/51 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..244
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.