DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and Cbx3

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001341931.1 Gene:Cbx3 / 12417 MGIID:108515 Length:183 Species:Mus musculus


Alignment Length:107 Identity:33/107 - (30%)
Similarity:51/107 - (47%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 GRRNAGTKKADDSIDPEKQWEVEKILDHVATKEGDMFKIRWKKYGPKDDSWEPSKNLACDALIEK 278
            |::..|..|..:..:|| ::.|||:||.........:.::||.:...|::|||.:||.|..|||.
Mouse    12 GKKQNGKSKKVEEAEPE-EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEA 75

  Fly   279 FMRKQATQENVD---VKELRES------PKKTERLVDECYPR 311
            |:..|...:..|   .|.|.:|      .||.....|:  ||
Mouse    76 FLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADK--PR 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 18/50 (36%)
Cbx3NP_001341931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 3/15 (20%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 18/48 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..125 10/40 (25%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 33/107 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.