DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8289 and cbx8a

DIOPT Version :9

Sequence 1:NP_573229.1 Gene:CG8289 / 32741 FlyBaseID:FBgn0030854 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_991179.2 Gene:cbx8a / 100150672 ZFINID:ZDB-GENE-040405-1 Length:342 Species:Danio rerio


Alignment Length:109 Identity:25/109 - (22%)
Similarity:47/109 - (43%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 EKQWEVEKILDHVATKEGDM-FKIRWKKYGPKDDSWEPSKNLACDALIEKFMRKQATQENVDVKE 293
            |:.:..|.|:.. ..:.|.| :.::||.:..|..:|||.:|:..:.|...|..::..:|....| 
Zfish     8 ERVFAAESIIKR-RIRRGRMEYLVKWKGWSQKYSTWEPEENILDERLFAAFEEREREREMYGPK- 70

  Fly   294 LRESPKKTERLVDECYPRTNLHNRIERSSKRSSAKNRIF-YGEE 336
             :..||          |.|.|      ...::.||::.: :|.|
Zfish    71 -KRGPK----------PETFL------MKAKAKAKSKTYEFGRE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8289NP_573229.1 CHROMO 233..284 CDD:214605 13/51 (25%)
cbx8aNP_991179.2 Chromo <27..57 CDD:278797 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.