DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-24 and Ndufv2

DIOPT Version :9

Sequence 1:NP_001285378.1 Gene:ND-24 / 32740 FlyBaseID:FBgn0030853 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_112326.1 Gene:Ndufv2 / 81728 RGDID:621733 Length:248 Species:Rattus norvegicus


Alignment Length:244 Identity:156/244 - (63%)
Similarity:190/244 - (77%) Gaps:13/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AVRANIRAIATSSARASDN-------------LFVHRDTPEDNPNIPFEFTAENKKRVEAILSIY 63
            |:||....:.....|.:.|             |||||||||:||:.||:||.||.:|:|||:..|
  Rat     5 ALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYERIEAIVRNY 69

  Fly    64 PEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPTGKYHIQVC 128
            ||||:..|::|:|||||||.||||||||:||||:||:|.||||||||||||:.|||.||||||||
  Rat    70 PEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVC 134

  Fly   129 TTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGACVNAPMVAINDDYYEDLTSKD 193
            |||||.||.||.||||.:::|||.||:||.|:.||:.||||||||||||||.||||||||||.||
  Rat   135 TTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDDYYEDLTPKD 199

  Fly   194 MQDILNDLKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGLQAGL 242
            :::|:::|:|.|:..||||:|||..||.|..|||:|.|||||||:||||
  Rat   200 IEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-24NP_001285378.1 2Fe-2S_thioredx 56..202 CDD:396008 105/145 (72%)
Ndufv2NP_112326.1 NuoE 50..211 CDD:224817 114/160 (71%)
2Fe-2S_thioredx 62..208 CDD:279582 105/145 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..248 13/18 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340850
Domainoid 1 1.000 227 1.000 Domainoid score I2426
eggNOG 1 0.900 - - E1_COG1905
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10884
Inparanoid 1 1.050 324 1.000 Inparanoid score I2404
OMA 1 1.010 - - QHG54082
OrthoDB 1 1.010 - - D1396088at2759
OrthoFinder 1 1.000 - - FOG0004458
OrthoInspector 1 1.000 - - oto97346
orthoMCL 1 0.900 - - OOG6_101311
Panther 1 1.100 - - LDO PTHR10371
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3749
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.