DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-24 and ND-24L

DIOPT Version :9

Sequence 1:NP_001285378.1 Gene:ND-24 / 32740 FlyBaseID:FBgn0030853 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_648965.1 Gene:ND-24L / 39926 FlyBaseID:FBgn0036706 Length:238 Species:Drosophila melanogaster


Alignment Length:196 Identity:109/196 - (55%)
Similarity:144/196 - (73%) Gaps:0/196 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IPFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEV 108
            :.|||:.:|::||:|:|:.||:...:||::||||:||||.|||.|||:..|||.:::..|..:|.
  Fly    32 LKFEFSKDNQRRVKALLAWYPQAEWKGALLPLLDIAQRQQGWLSISAVQAVAETIKIDPMEAFEA 96

  Fly   109 ATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGAC 173
            |.|||||..||.|||.:.|||:|||.|||.|:|.|.|||.|.:..|.||.|.:||:.|..|:|||
  Fly    97 AQFYTMFFMKPRGKYVVSVCTSTPCKLRGGDEIFEACKKTLNLEHGQTTPDMQFTLKEDYCMGAC 161

  Fly   174 VNAPMVAINDDYYEDLTSKDMQDILNDLKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGL 238
            ||||::|:|||.||||..|.:.:||.||:.||:.|.|||||||||||||..|:|..:|..|||.:
  Fly   162 VNAPVLAVNDDMYEDLDEKSLANILADLRNDKLPPAGPRNGRFASEPKGGLTTLKIQPPPPGFMM 226

  Fly   239 Q 239
            |
  Fly   227 Q 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-24NP_001285378.1 2Fe-2S_thioredx 56..202 CDD:396008 80/145 (55%)
ND-24LNP_648965.1 NuoE 34..193 CDD:224817 86/158 (54%)
2Fe-2S_thioredx 44..190 CDD:279582 80/145 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449124
Domainoid 1 1.000 156 1.000 Domainoid score I1322
eggNOG 1 0.900 - - E1_COG1905
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I1304
Isobase 1 0.950 - 0 Normalized mean entropy S1990
OMA 1 1.010 - - QHG54082
OrthoDB 1 1.010 - - D1396088at2759
OrthoFinder 1 1.000 - - FOG0004458
OrthoInspector 1 1.000 - - otm51360
orthoMCL 1 0.900 - - OOG6_101311
Panther 1 1.100 - - P PTHR10371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R804
SonicParanoid 1 1.000 - - X3749
1413.790

Return to query results.
Submit another query.