DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-24 and ndufv2

DIOPT Version :9

Sequence 1:NP_001285378.1 Gene:ND-24 / 32740 FlyBaseID:FBgn0030853 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_957041.1 Gene:ndufv2 / 393720 ZFINID:ZDB-GENE-040426-1713 Length:244 Species:Danio rerio


Alignment Length:242 Identity:151/242 - (62%)
Similarity:190/242 - (78%) Gaps:1/242 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTNCASKTLAAVRANIRAIATSSARA-SDNLFVHRDTPEDNPNIPFEFTAENKKRVEAILSIYPE 65
            |::.....::.....:|::..:|||| :..:||||||||:||:.|||||.||.||||||::.|||
Zfish     3 LSSTLRSAVSYTARQVRSLHQTSARAGAGGIFVHRDTPENNPDTPFEFTPENMKRVEAIINNYPE 67

  Fly    66 GHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPTGKYHIQVCTT 130
            |||..|.||:|||||||.||||||||:||||:|.:..|||||||||||||:|:|.||||||:|||
Zfish    68 GHKAAATIPVLDLAQRQNGWLPISAMNKVAEVLGIAPMRVYEVATFYTMFLRQPVGKYHIQICTT 132

  Fly   131 TPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGACVNAPMVAINDDYYEDLTSKDMQ 195
            |||.|..||.|||..:.:|||.||:||.|:.||::||||||||||||||.|||:|||||...||:
Zfish   133 TPCMLCDSDSILEAIQNKLGIKVGETTADKLFTLTEVECLGACVNAPMVQINDNYYEDLKPSDME 197

  Fly   196 DILNDLKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGLQAGL 242
            .|:::|||.::.|||||:|||:.||.|..|||:|.|.|||.|::|.|
Zfish   198 QIIDELKAGRVPPPGPRSGRFSCEPAGGLTSLTEPPPGPGVGVRADL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-24NP_001285378.1 2Fe-2S_thioredx 56..202 CDD:396008 101/145 (70%)
ndufv2NP_957041.1 NuoE 46..206 CDD:224817 112/159 (70%)
2Fe-2S_thioredx 58..204 CDD:279582 101/145 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580698
Domainoid 1 1.000 217 1.000 Domainoid score I2637
eggNOG 1 0.900 - - E1_COG1905
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10884
Inparanoid 1 1.050 314 1.000 Inparanoid score I2544
OMA 1 1.010 - - QHG54082
OrthoDB 1 1.010 - - D1396088at2759
OrthoFinder 1 1.000 - - FOG0004458
OrthoInspector 1 1.000 - - oto41171
orthoMCL 1 0.900 - - OOG6_101311
Panther 1 1.100 - - LDO PTHR10371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R804
SonicParanoid 1 1.000 - - X3749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.