DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-24 and SPAC11E3.12

DIOPT Version :9

Sequence 1:NP_001285378.1 Gene:ND-24 / 32740 FlyBaseID:FBgn0030853 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001342840.1 Gene:SPAC11E3.12 / 2542955 PomBaseID:SPAC11E3.12 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:49/169 - (28%)
Similarity:79/169 - (46%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYG-WLPISAMHKVAEILQLPNMRVYEVATF 111
            |..||.:..:|||:.||...:..|::|||||||||:| |:|.:||:::|.:..:....|:.:...
pombe     7 FKPENLQLAKAILARYPLRFQSAALVPLLDLAQRQHGTWIPPTAMYEIASLAGVSIDYVHSLILA 71

  Fly   112 Y-TMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRK---------FTISE 166
            | ..|..:|. |..:::|.:..|             :|.....|::..|.:         |.:..
pombe    72 YPNDFFWRPK-KPRVRICNSWMC-------------QQAAEEQGNSNWDSQCRSVATKYGFDVEN 122

  Fly   167 VECLGACVNAPMVAINDDYYEDLTSKDMQDILNDLKADK 205
            ..|||.|...|.:.|||..|...|.:.:.||:..|...|
pombe   123 TGCLGNCFQGPAMWINDKIYGVNTKEKLVDIMEALTQKK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-24NP_001285378.1 2Fe-2S_thioredx 56..202 CDD:396008 44/156 (28%)
SPAC11E3.12NP_001342840.1 NuoE 7..161 CDD:224817 48/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2942
eggNOG 1 0.900 - - E1_COG1905
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1953
OMA 1 1.010 - - QHG54082
OrthoFinder 1 1.000 - - FOG0004458
OrthoInspector 1 1.000 - - otm47075
orthoMCL 1 0.900 - - OOG6_101311
Panther 1 1.100 - - LDO PTHR10371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R804
SonicParanoid 1 1.000 - - X3749
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.