DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-24 and F53F4.10

DIOPT Version :9

Sequence 1:NP_001285378.1 Gene:ND-24 / 32740 FlyBaseID:FBgn0030853 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_506376.1 Gene:F53F4.10 / 179850 WormBaseID:WBGene00009992 Length:239 Species:Caenorhabditis elegans


Alignment Length:212 Identity:145/212 - (68%)
Similarity:177/212 - (83%) Gaps:0/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LFVHRDTPEDNPNIPFEFTAENKKRVEAILSIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVA 95
            |.|||||.|:|.|:.|:||:||::|::||:.|||||||.||:||||||||||:|||||||||:||
 Worm    27 LMVHRDTKENNLNVKFKFTSENQERIKAIMDIYPEGHKAGALIPLLDLAQRQHGWLPISAMHEVA 91

  Fly    96 EILQLPNMRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDR 160
            :||::|.||.||||||||||.|:|.|||.:|||.||||.|||::.|.||.:|:|||..|:||||.
 Worm    92 KILEVPRMRAYEVATFYTMFNRQPVGKYFLQVCATTPCMLRGAETITETIEKKLGIHAGETTKDG 156

  Fly   161 KFTISEVECLGACVNAPMVAINDDYYEDLTSKDMQDILNDLKADKISPPGPRNGRFASEPKGEPT 225
            .||::|||||||||||||:.|||||:||||.||:.:||:||||.:....|||:||.|:||.||.|
 Worm   157 LFTLAEVECLGACVNAPMIQINDDYFEDLTPKDVNEILDDLKAGRKPAAGPRSGRLAAEPFGELT 221

  Fly   226 SLSEEPKGPGFGLQAGL 242
            ||.|.|.||||||||.|
 Worm   222 SLKETPPGPGFGLQAAL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-24NP_001285378.1 2Fe-2S_thioredx 56..202 CDD:396008 103/145 (71%)
F53F4.10NP_506376.1 NuoE 42..200 CDD:224817 111/157 (71%)
2Fe-2S_thioredx 52..198 CDD:279582 103/145 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159348
Domainoid 1 1.000 229 1.000 Domainoid score I1402
eggNOG 1 0.900 - - E1_COG1905
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10884
Inparanoid 1 1.050 310 1.000 Inparanoid score I1557
Isobase 1 0.950 - 0 Normalized mean entropy S1990
OMA 1 1.010 - - QHG54082
OrthoDB 1 1.010 - - D1396088at2759
OrthoFinder 1 1.000 - - FOG0004458
OrthoInspector 1 1.000 - - oto18833
orthoMCL 1 0.900 - - OOG6_101311
Panther 1 1.100 - - LDO PTHR10371
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R804
SonicParanoid 1 1.000 - - X3749
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.