DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rrad and Rgk1

DIOPT Version :9

Sequence 1:XP_021333082.1 Gene:rrad / 327396 ZFINID:ZDB-GENE-030131-5607 Length:304 Species:Danio rerio
Sequence 2:NP_725875.3 Gene:Rgk1 / 14462605 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster


Alignment Length:354 Identity:101/354 - (28%)
Similarity:158/354 - (44%) Gaps:90/354 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish     7 LNKGDKLRNMDKRRGSMPFPLHLQTLHRRSMPVDDRELRSMPAAQPSELPGLMRFNADRNSCVSD 71
            :|:||.|::...|..:.....:..|.|     :..::..|.||:..:           |.|..|.
  Fly  1060 VNRGDSLKSRRSRSNNSVASSNSSTEH-----LTTQQQLSAPASVSA-----------RTSLASS 1108

Zfish    72 SSDSVISSGSDSDGQVYKVVLLGEHGVGKSSLARIFGGVE-----DSNDCEETGNTYDRSLVVDD 131
            ...|..:.|:..    |:|::||...||||||...|...|     |::..:|:|.. ..|:::..
  Fly  1109 RESSTSNPGNGP----YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEK-AVSVLLSG 1168

Zfish   132 EETSILLYDIWEQDNSQWLQDQCMRMGD--AYIIVYSVTDKSSFEKASELRIQLRRARQSENI-- 192
            ||:.::..|   ...::...|:|:...|  .|.::||..|:|||..|.::   |:....::||  
  Fly  1169 EESELIFID---HGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQV---LQVLWTNQNIAQ 1227

Zfish   193 -PIILVGNKSDLVRSREVSMDEGSACAVVFDCKFIETSASLHHNVRDLFEGIVRQIRLRKDSKEE 256
             .:|||.||:||.|||.|:.:||.|.|..:||||||||..::|||.:|..|::.||||:.::.|:
  Fly  1228 KAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEK 1292

Zfish   257 N-----ARRMANCKR-----------------------------------------RESISKKAK 275
            :     .|.:...||                                         |.|.|.|.|
  Fly  1293 SRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVK 1357

Zfish   276 RFLGRMVARKNKKMAFRQKSKSCHDLSVL 304
            ..|||:..|.:       |||||.:|.||
  Fly  1358 GLLGRVWTRDS-------KSKSCENLHVL 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rradXP_021333082.1 RGK 88..304 CDD:206715 84/271 (31%)
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 84/271 (31%)
small_GTPase 1121..1286 CDD:197466 64/171 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109169
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5084
SonicParanoid 1 1.000 - - X743
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.