DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and AT4G17790

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_567541.1 Gene:AT4G17790 / 827501 AraportID:AT4G17790 Length:264 Species:Arabidopsis thaliana


Alignment Length:228 Identity:86/228 - (37%)
Similarity:135/228 - (59%) Gaps:3/228 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYV 150
            :|:.:..::.:..||...|:   |:...||:||:::|.::|...|:.|...|..:|:.|..:.||
plant    38 SGVVLGFILGLVCVYLTMPQ---SDYSFLKLPRNLEDLQILRDNLEIYTSDYTVQVLVGYCLVYV 99

  Fly   151 FLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWS 215
            |:|||.|||::|:|:|.|.|:.....:.|:...:..||:.||.||.|:||.|:...||.|...:.
plant   100 FMQTFMIPGTVFMSLLAGALFGVVKGMALVVSTATAGASSCYFLSKLIGRPLLFSLWPDKLVFFQ 164

  Fly   216 KHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQ 280
            ..|...:|.|.|||||||:||.|||.|||:|||::.||.|||.|.||.|:.|.:.:.::||..|.
plant   165 DQVARRKDRLLNYMLFLRLTPTLPNTFINVASPIVDVPYHIFFLATFIGLIPAAFVTVRAGLALG 229

  Fly   281 KMTSSSEAFSWTSMGILMACACASLLPGLLKNK 313
            ::.|..:.:.::||..|......|:.|.|:..|
plant   230 ELKSLGDLYDFSSMATLCLIGVLSVTPTLIGKK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 53/118 (45%)
AT4G17790NP_567541.1 TVP38 <91..228 CDD:223475 62/136 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1861
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42740
Inparanoid 1 1.050 171 1.000 Inparanoid score I1532
OMA 1 1.010 - - QHG54676
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 1 1.000 - - otm2738
orthoMCL 1 0.900 - - OOG6_102890
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.