DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and AT4G09580

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_192696.3 Gene:AT4G09580 / 826542 AraportID:AT4G09580 Length:287 Species:Arabidopsis thaliana


Alignment Length:274 Identity:94/274 - (34%)
Similarity:144/274 - (52%) Gaps:8/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DLNPQQQQQQQQQQQATPQKQAMSADEK---KATKK-----SLVIVAGIFVASLVTMCYVYAIFP 104
            |...:|..:.::...|:...:.:..|:.   |.||.     |....|..|...||....::.|:.
plant    10 DGGARQLVKDEESPAASSAAKGLLNDDSPTGKRTKSERFPLSRWEFAVFFTVFLVFTTGLFCIYL 74

  Fly   105 ELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGF 169
            .:.|:|...||:||.|.|.::|.:.|..|...|....:.|....|:|:|||.|||::|:|:|.|.
plant    75 TMPAAEYGKLKVPRTISDLRLLKENLGSYASEYQARFILGYCSTYIFMQTFMIPGTIFMSLLAGA 139

  Fly   170 LYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRM 234
            |:.......|:...:..||..|:.||.||||.|:...||:|...:...:.:.||.|.|||||||:
plant   140 LFGVVRGFVLVVLNATAGACSCFFLSKLVGRPLVNWLWPEKLRFFQAEIAKRRDRLLNYMLFLRI 204

  Fly   235 TPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMA 299
            ||.|||.||||:||::.:|.|:|.|.|..|:.|.|.|.::||..|..:.|..:.:.:.::.:|..
plant   205 TPTLPNLFINLSSPIVDIPFHVFFLATLVGLMPASYITVRAGLALGDLRSVKDLYDFKTLSVLFL 269

  Fly   300 CACASLLPGLLKNK 313
            ....|:.|.|||.|
plant   270 IGSISIFPALLKRK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 52/118 (44%)
AT4G09580NP_192696.3 SNARE_assoc 104..284 CDD:412374 70/180 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1861
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1532
OMA 1 1.010 - - QHG54676
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 1 1.000 - - otm2738
orthoMCL 1 0.900 - - OOG6_102890
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.