DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and Tmem41a

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001094275.1 Gene:Tmem41a / 681708 RGDID:1591692 Length:264 Species:Rattus norvegicus


Alignment Length:239 Identity:85/239 - (35%)
Similarity:139/239 - (58%) Gaps:3/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVIVAGIFVASLVTMCYVYAIFPELNAS---EKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMF 143
            |::|.|....:|..:.....:.|.|.::   |.:.|..|.|:.:.:.||:||..|:..:...|:.
  Rat     7 LLLVFGGCTFALYLLSTRLPLGPRLGSAGEPEGRSLWFPSDLAELRELAEVLREYRKEHQAYVIL 71

  Fly   144 GVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWP 208
            ....||::.|.||||||.||::|.|.|:...:.|.|.|..:::|||.||.||::.|::|:..::|
  Rat    72 LFCSAYLYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSVFGKQLVVSYFP 136

  Fly   209 KKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAI 273
            .|.:...:.|||.|:.||.::||||:.|:.||||:||::|::.:|:..|......|:.|.:.|.:
  Rat   137 DKVALLQRKVEENRNGLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYNFICV 201

  Fly   274 QAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFKHK 317
            |.|..|..:||....|||.::..|:|.|..:|:||.|..||..|
  Rat   202 QTGSILSTLTSLDALFSWETVLKLLAIAMVALVPGTLIKKFSQK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 47/118 (40%)
Tmem41aNP_001094275.1 SNARE_assoc 85..205 CDD:286425 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.