DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and tmem64

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001121723.1 Gene:tmem64 / 564172 ZFINID:ZDB-GENE-060503-182 Length:348 Species:Danio rerio


Alignment Length:201 Identity:45/201 - (22%)
Similarity:89/201 - (44%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTFA 156
            |.:..|.:.|:.....|..:|:||      |..:..:.||.         :.|.::..|.|.|.:
Zfish    89 SALLACVLTAVCFSSVALVRQYLK------DVLLWVESLDS---------LVGAMLFIVGLITVS 138

  Fly   157 IP---GSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKK--TSEWSK 216
            .|   |.:.|::..|:||.|.:.:.|:    .:|..:...::::|.:||:.::...|  :||...
Zfish   139 FPCGWGYIVLNVAAGYLYGFVLGMGLV----MVGVLIGTFIAHVVCKRLLTNWVLSKIGSSEQLS 199

  Fly   217 HVEEYRD--SLFNYMLFLRMTPI---LPNWFINLASPVIGVPLHIFALGTFCGVAPPSVIAIQAG 276
            .|....:  |....:...|:|||   |.|...:::...:.:|.::.|  :..|:.|..::....|
Zfish   200 AVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSVSITDVSLPNYLVA--SSVGLLPTQLLNSYLG 262

  Fly   277 KTLQKM 282
            .||:.|
Zfish   263 TTLRTM 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 27/128 (21%)
tmem64NP_001121723.1 TVP38 91..263 CDD:223475 40/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.