DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and tmem41ab

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_998248.1 Gene:tmem41ab / 406356 ZFINID:ZDB-GENE-040426-2050 Length:278 Species:Danio rerio


Alignment Length:253 Identity:86/253 - (33%)
Similarity:136/253 - (53%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IFVASLVTMCYVYAIF--------------PELNASEKQ----HLKIPRDIQDAKMLAKVLDRYK 134
            :.||:.....|:.:.|              ||....|.:    .||.|.|:::.:.||::|..||
Zfish     9 VLVAAATFYLYLLSAFLPPGPRAIRVHDTGPEHTDDEPEEKVLRLKFPSDLEELRELAELLKFYK 73

  Fly   135 DMY--YFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNL 197
            ..:  |..::|  ..||::.|:||||||.||::|.|.|:.....|.:.|..:.:|:|.||.||..
Zfish    74 TEHTGYVFILF--CSAYLYKQSFAIPGSSFLNMLSGALFGPLHGLIIACTLTTVGSTNCYLLSRT 136

  Fly   198 VGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTF 262
            .|:|.|...:|:|.:...:.|||.|.|||.::||||..|:.||||:|:.||::.:|:.||.....
Zfish   137 FGKRHIVRLFPEKVAMLQRMVEENRSSLFFFLLFLRFFPMTPNWFLNVTSPILNIPIPIFFFSIL 201

  Fly   263 CGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLLKNKFK--HKK 318
            .|:.|.:.|.:..|..|.::.|..:.|||.::..|:..||.:||||.|..::.  |.|
Zfish   202 IGLIPYNFICVHTGAVLSEINSLDDIFSWFTLLQLLLIACVALLPGALIRRYSKDHLK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 47/118 (40%)
tmem41abNP_998248.1 SNARE_assoc 96..217 CDD:286425 48/120 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.