DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and Y71A12C.2

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_493447.2 Gene:Y71A12C.2 / 190582 WormBaseID:WBGene00013513 Length:253 Species:Caenorhabditis elegans


Alignment Length:233 Identity:75/233 - (32%)
Similarity:127/233 - (54%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LVIVAGIFVASLVTMCYVYAIF-----PELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMY--YF 139
            |::|  .|.||||    :||::     ||    ..|..:.|||::..:.|:..|.:|::.:  |.
 Worm     7 LLLV--FFGASLV----LYAVWSYGPLPE----GAQRPRFPRDLEGLRELSSSLTKYEESHAAYT 61

  Fly   140 EVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIR 204
            .::|.  .||::.||||||||.|:::|.|.|:.....:.|:|..:|:||:||:.||.|....::.
 Worm    62 VLLFS--AAYLYKQTFAIPGSFFMNLLAGALFGTVRGVALVCSLNAVGASLCFCLSALFAAPIVD 124

  Fly   205 HFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPS 269
            .|...:.......|...||.|:.::|..|:.|..|:|.:|::||.:.|||...|...|.|:.|.:
 Worm   125 RFLKSRIESLRCLVNAERDRLWFFLLSARIFPFTPHWLLNISSPFLDVPLRYHASSVFVGLFPYN 189

  Fly   270 VIAIQAGKTLQKMTSSSEAFS-WT-----SMGILMACA 301
            ::.::||..|.::.|.|:.|. ||     |:.:|:..|
 Worm   190 LLCVRAGTVLAEVNSMSDVFDVWTLSELFSVSLLLLVA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 38/118 (32%)
Y71A12C.2NP_493447.2 SNARE_assoc 50..197 CDD:294297 49/148 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222755at2759
OrthoFinder 1 1.000 - - FOG0001464
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.