DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stas and Tmem64

DIOPT Version :9

Sequence 1:NP_573225.1 Gene:stas / 32737 FlyBaseID:FBgn0030850 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_852066.2 Gene:Tmem64 / 100201 MGIID:2140359 Length:381 Species:Mus musculus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:84/207 - (40%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SLVTMCYVYAI-FPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTF 155
            |||.:|.:.|: |..|       ..:.|.:|...:..:.||....:..|.|.| :||::      
Mouse   123 SLVLVCVLAALCFASL-------ALVRRYLQHLLLWVESLDSLLGVLLFVVGF-IVVSF------ 173

  Fly   156 AIP---GSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKH 217
              |   |.:.|::..|:||.|.:.:.|:    .:|..:...::::|.:||:        :.|...
Mouse   174 --PCGWGYIVLNVAAGYLYGFVLGMGLM----VVGVLIGTFIAHVVCKRLL--------TAWVAA 224

  Fly   218 VEEYRDSL------------FNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSV 270
            ..:..|.|            ...:...|:||| |....|....:..|||..:.:.:..|:.|..:
Mouse   225 RIQNSDKLSAVIRVVEGGSGLKVVALARLTPI-PFGLQNAVFSITDVPLPSYLMASSAGLLPTQL 288

  Fly   271 IAIQAGKTLQKM 282
            :....|.||:.|
Mouse   289 LNSYLGTTLRTM 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stasNP_573225.1 SNARE_assoc 157..276 CDD:286425 26/133 (20%)
Tmem64NP_852066.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
TVP38 124..295 CDD:223475 41/199 (21%)
VTT domain. /evidence=ECO:0000250|UniProtKB:P36164 187..297 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.