Sequence 1: | NP_573225.1 | Gene: | stas / 32737 | FlyBaseID: | FBgn0030850 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_852066.2 | Gene: | Tmem64 / 100201 | MGIID: | 2140359 | Length: | 381 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 46/207 - (22%) |
---|---|---|---|
Similarity: | 84/207 - (40%) | Gaps: | 45/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 SLVTMCYVYAI-FPELNASEKQHLKIPRDIQDAKMLAKVLDRYKDMYYFEVMFGVVVAYVFLQTF 155
Fly 156 AIP---GSLFLSILLGFLYKFPIALFLICFCSALGATLCYTLSNLVGRRLIRHFWPKKTSEWSKH 217
Fly 218 VEEYRDSL------------FNYMLFLRMTPILPNWFINLASPVIGVPLHIFALGTFCGVAPPSV 270
Fly 271 IAIQAGKTLQKM 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
stas | NP_573225.1 | SNARE_assoc | 157..276 | CDD:286425 | 26/133 (20%) |
Tmem64 | NP_852066.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | ||
TVP38 | 124..295 | CDD:223475 | 41/199 (21%) | ||
VTT domain. /evidence=ECO:0000250|UniProtKB:P36164 | 187..297 | 24/122 (20%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0398 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |