DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and ASIC5

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:537 Identity:116/537 - (21%)
Similarity:191/537 - (35%) Gaps:146/537 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EFFQNSTLHGVRYIAESGRPIGEKFMWFCFT--SIGAVTALVIIMSLWEKFQTNPTITGLDTDFH 95
            :|..:::.||:..|.::...| .:.:|....  |:..||..:.|..|  .:.|.||.|.::..: 
Human    40 DFAISTSFHGIHNIVQNRSKI-RRVLWLVVVLGSVSLVTWQIYIRLL--NYFTWPTTTSIEVQY- 100

  Fly    96 NQNVVFPTTVVCPEAAFDHDKTYE--------KVYNTLANYDEAQAQMYTPFLRILTSLNFENVR 152
            .:.:.||....|....|..|...:        .:.:.:.:..|..|             |....|
Human   101 VEKMEFPAVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLHLQEITA-------------NSTGSR 152

  Fly   153 DAKVLSQSIPQNLLDAHTIREWAF----EGHIDCKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCY 213
            :|...:.| .||......||...|    ...:||:.....|..:|        |..::||:|.|:
Human   153 EATDFAAS-HQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKD--------FAHVFTEYGNCF 208

  Fly   214 AFNSRFKSTPTEDVKTGAPH-DLYETDKKWALFFIPNSTSRIFIFS-NEEYFGSDFNAQIDWSEP 276
            .||                | :..:..:|.::    :......:|: |:|.|..  |..:.:.:.
Human   209 TFN----------------HGETLQAKRKVSV----SGRGLSLLFNVNQEAFTD--NPALGFVDA 251

  Fly   277 QLVEVRISKKNTYTTDDARQLS---------IGQRKCIFSD--------EVKLNYFPDAYTFSSC 324
            .::.|..|.|.....|....||         |.|.|.:..:        .:||..| .:|:.|.|
Human   252 GIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPWGECNPNIKLQNF-SSYSTSGC 315

  Fly   325 MKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDFDCLD-- 387
            :|:|:.....|.|.| .||..|...:.|.:.                         |.|.|:.  
Human   316 LKECKAQHIKKQCGC-VPFLLPGYGIECDLQ-------------------------KYFSCVSPV 354

  Fly   388 ----EFKSNITNIKDCLQCELSC---------SKTVFNIDKLIKMSDRP---------ESLGVLV 430
                |||...|.......|.:||         |.:.|...|.:|...:.         |:| |.:
Human   355 LDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENL-VKI 418

  Fly   431 EF----LTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEII-YYFT-LRACCMVYKNR 489
            |.    |.:.|.:.::.|...  :||...||...||.|.||::.:||| |.|| ....|:.:   
Human   419 EINYSDLNYKITQQQKAVSVS--ELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFF--- 478

  Fly   490 QELYEIEEKIRQEPPPK 506
              |.:|.|..:..|||:
Human   479 --LLKISEMTQWTPPPQ 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 106/503 (21%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 106/502 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.