DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and ppk30

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster


Alignment Length:423 Identity:96/423 - (22%)
Similarity:170/423 - (40%) Gaps:74/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 TDFHNQNVVFPTTVVCP-EAAFDHDKTYEKVYNTLANYDEAQAQMY-TPFLRILTSLNFENVRDA 154
            ||.|...:.||...:.| ..:....:...|.||.:      |:.:: ||....||..||....: 
  Fly    76 TDMHVSEIDFPAVTIIPINLSILKAEKLSKAYNLV------QSVVWQTPMSARLTDENFTEFSE- 133

  Fly   155 KVLSQSIPQNLLDAHTIREWAFEG--HIDCKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCYAFNS 217
                       |:....:.|....  .::|::.|..|::|.:.:.|||.|.|..|.:||.:.|||
  Fly   134 -----------LENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNS 187

  Fly   218 -----RFKSTPTEDVKTGAPHDLYETDKKWALFFIPNSTSRIFIFSNEEYFGSDFNAQIDWSEPQ 277
                 |.::.|......|:...|....|:....:..| |..:.:....:..|    ..||:|...
  Fly   188 LVSSGRDETWPWSVASCGSYSGLNVKIKRQQGLYTLN-TMGVIVHEPTQLLG----MSIDYSSED 247

  Fly   278 LVEVRISKKNTYTTDDARQLSIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKCNPP 342
            .:.|.:...:.....|.|...:..|:|.|.:|:     |...:.|.|:.:|.:|..|..|.|:  
  Fly   248 RIVVPVEPLHFTAELDVRARPVQMRRCYFENEI-----PTGKSRSECIYKCHVNYIISKCNCS-- 305

  Fly   343 FYKPIRELSCVINIFTNLIAYILLLYLTPKAN-VPMCSIKDFDC--------------LDEFKSN 392
            ...|::......||..           ..::| ..:|.:||..|              ::|.:.|
  Fly   306 LELPVKATQDEDNIAA-----------AKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDN 359

  Fly   393 ITNIKDCLQCELSCSKTVFN----IDKLIKMSDRPESLGVLVEFLTWPIIRYKREVLFGWVDLLV 453
            :.:..|| .|...|..|.::    .:|:...::...::.:.|.|....:..|:..:.|..:||:|
  Fly   360 VFSTVDC-GCFPQCGHTQYHTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMV 423

  Fly   454 SFGGIASLFLGFSLLSGV-EIIYYFTLRACCMV 485
            |:||||.|.:|.|:|..: |::..|   |||.:
  Fly   424 SYGGIAGLIMGISVLGCINELLDRF---ACCRI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 92/412 (22%)
ppk30NP_001263076.1 ASC 47..446 CDD:279230 92/411 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.