DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and asic4b

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:590 Identity:120/590 - (20%)
Similarity:212/590 - (35%) Gaps:184/590 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FFQNSTLHGV-RYIAESGRPIGEKFMW--FCFTSIGAVTALVIIMSLWE--KFQTNPTITGLDTD 93
            |..:|:|||: |.:..|.|....:.:|  ....|:|    |.:..:.|.  .:...|.:..|..:
Zfish    47 FASSSSLHGLARALGTSERLGFRQTLWGLALLVSLG----LFLYQATWSAATYLERPHLAALREE 107

  Fly    94 FHNQNVVFPTTVVCPEAAFDHDK-TYEKVYNTLANYDEAQAQMYTPFLRILTSL---NFENVRDA 154
            ...: :.||...:|....|.... |...:|: |||               ||.|   :.:..|.:
Zfish   108 TRRE-LTFPAITLCNVNRFRFSALTDADIYH-LAN---------------LTGLPPKSRKGHRPS 155

  Fly   155 KVLSQSIPQNLLDAHTIREWAFE--GHIDCKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCYAFNS 217
            ::  |..|.|:||       .|:  || ..:::..||.:..::....| |..:||.:|.||.||.
Zfish   156 EL--QYPPPNMLD-------IFQRTGH-QLEDMLKSCNFSGQNCSSED-FSVVYTRYGKCYTFNG 209

  Fly   218 RFKSTPTEDVKTGAPHDL-----YETDKKWALFFIPNSTSRIFIFSNEEYFGSDFNAQI-DWSEP 276
            . |::|....:.|..:.|     .:.|:     ::|     |:..:||....:....|| ..:||
Zfish   210 N-KTSPKRVRQGGTGNGLEMMLDIQQDE-----YLP-----IWRETNETTLEAGIRVQIHSQNEP 263

  Fly   277 QLVEVRISKKNTYTTDDARQL----SIGQRKCIFSDEVKLNYFP-----------------DAYT 320
            ..:               .||    |.|.:..:...|.:|.|.|                 |.|:
Zfish   264 PYI---------------HQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRASSEPVIPGYDTYS 313

  Fly   321 FSSCMKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDFDC 385
            .|:|...|...:..:.|.|.                         ::::...|::  |:.....|
Zfish   314 VSACRLHCESTQVQRECNCR-------------------------MVHMPGDADI--CAPSKIKC 351

  Fly   386 LDEFKSNI-TNIKDCLQCELSCSKTVFNID-KLIKMSDRPES--------------------LGV 428
            :|:..::: .:..|...||..|:.|.:..: .::|:..|..:                    |.:
Zfish   352 VDKALASLQKSTGDSCPCETPCNLTRYGKELSMVKIPSRGSARYLSRKYQKSEEYIRDNFLILDI 416

  Fly   429 LVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRACCMVYKNRQELY 493
            ..|.|.:..|..|:  .:....||...||...||:|.|:|:.:||:.|               :|
Zfish   417 FFEALNYETIEQKK--AYDIAGLLGDIGGQMGLFIGASILTILEILDY---------------IY 464

  Fly   494 EI-EEKIRQEPPPK---------------IDLKLSLKSHNPRIGDTPTSAV------LKVKPAEE 536
            |: :.||:|...||               |....:|:..|.:...|..:..      :|||.|.:
Zfish   465 EVAKNKIKQLLKPKKSQKQTNQRNLIQEQIQRTKNLREQNLKAQLTAGAIATVRFEEVKVKAAND 529

  Fly   537 SAGPN 541
            .|.|:
Zfish   530 VAQPH 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 102/501 (20%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 108/544 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.