DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and ASIC2

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:588 Identity:131/588 - (22%)
Similarity:221/588 - (37%) Gaps:164/588 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QRFLETLVIFRRSLIYQTKEFFQNSTLHGVRYIAESGRPIGEKF----MW---FCFTSIGAVTAL 71
            :|.|:...:.||.     :.....:.|||:|::.......|..|    :|   || ||.|    |
Human    45 ERALQGPGVARRG-----RPSLSRAKLHGLRHMCAGRTAAGGSFQRRALWVLAFC-TSFG----L 99

  Fly    72 VIIMS-----LWEKFQTNPTITGLDTDFHNQNVVFPTTVVC-------PEAA------FDH---- 114
            ::..|     .|..|   |:.|.:..::..| :.||...||       |..:      ..|    
Human   100 LLSWSSNRLLYWLSF---PSHTRVHREWSRQ-LPFPAVTVCNNNPLRFPRLSKGDLYYAGHWLGL 160

  Fly   115 ---DKTYEKVYNTLANYDEAQAQMY---TPFLRILTSLNFENVRDAKVLSQSIPQNLLDAHTIRE 173
               ::|...:.:.|...||.:.|.:   ..|...|...:||.:      |.:....|        
Human   161 LLPNRTARPLVSELLRGDEPRRQWFRKLADFRLFLPPRHFEGI------SAAFMDRL-------- 211

  Fly   174 WAFEGHIDCKNVFVSCKYRDEDIPCCDH-FEPIYTEHGFCYAFNSRFKSTP-TEDVKTGAPHDL- 235
                || ..:::.:|||||.|  .|..| |..::|::|.||.|||.....| ...||.|..:.| 
Human   212 ----GH-QLEDMLLSCKYRGE--LCGPHNFSSVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLE 269

  Fly   236 ----YETDKKWALFFIPNSTSRIFIFSNEEYFGSDFNAQI-DWSEPQLVE-----VRISKKNTYT 290
                .:.|:     ::|     |:..:.|..|.:....|| ..|||..::     |....:....
Human   270 IMLDIQQDE-----YLP-----IWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVA 324

  Fly   291 TDDARQLSI----GQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKC-------NPPFY 344
            |.:.|...:    |:.:   |.|:.|::|| .|:.::|...|.....::.|.|       :.||.
Human   325 TQEQRLTYLPPPWGECR---SSEMGLDFFP-VYSITACRIDCETRYIVENCNCRMVHMPGDAPFC 385

  Fly   345 KPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDFD-CLDEFKSNITNI-KDCLQCELSCS 407
            .|.:...|.                  :..:.:.:.||.: ||.....|:|.. |:....::...
Human   386 TPEQHKECA------------------EPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPSK 432

  Fly   408 KTVFNIDKLIKMSDRPESLGVLV-----EFLTWPIIRYKR--EVLFGWVDLLVSFGGIASLFLGF 465
            .:...::|....|::..|..:||     |.|.:..|..|:  ||    ..||...||...||:|.
Human   433 TSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKKAYEV----AALLGDIGGQMGLFIGA 493

  Fly   466 SLLSGVEIIYYFTLRACCMVYKNRQELYE-IEEKI-----RQEPPPKIDLKLS----LKSHNPRI 520
            |:|:.:|:..|               :|| |:||:     ::|.....|..:|    :.:|:..|
Human   494 SILTILELFDY---------------IYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSETI 543

  Fly   521 GDT 523
            ..|
Human   544 SHT 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 115/509 (23%)
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 127/564 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.