DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and ppk16

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_001334673.1 Gene:ppk16 / 3885612 FlyBaseID:FBgn0065108 Length:531 Species:Drosophila melanogaster


Alignment Length:539 Identity:122/539 - (22%)
Similarity:229/539 - (42%) Gaps:98/539 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HPPESRTQRFLETLVIFRRSLIYQTKEFFQNSTLHGVRYIAESGRPIGEKFMWFCFTSIGAVTAL 71
            |.|.....||.:....|..::    :.:.|.::|||..||........|::.|.....:..:|::
  Fly    36 HNPIQPQHRFRQIGEWFTENM----RNYCQTTSLHGFSYITRQDISRHERWFWLVVVILAIITSI 96

  Fly    72 VIIMSLWEKFQTNPTITGLDTD-FHNQNVVFPTTVVCPEAAFDHDKTYEKVYNT--LANYDEAQ- 132
            |:::..|...|..||:|.:::. |...|:.||...:|         .:.|:..:  |:..|:.| 
  Fly    97 VLVVVSWYWSQETPTVTVIESSHFPTWNIPFPAVTIC---------NFNKISKSKALSLLDQMQV 152

  Fly   133 ------AQMYTPF----LRILTSLNFENVRD-AKVLSQSIPQNLLDAHTIREWAFEGHIDCKNVF 186
                  ::::..|    |.:.|.::.::::. .::||       |:..|:.....:...||..:.
  Fly   153 PVGINRSELHNLFNLTLLPVDTMISNDSLQKYDRILS-------LNNLTLNRLTQQLSPDCIEMI 210

  Fly   187 VSCKYRDEDIPCCDHFEPIYTEHGFCYAFN--SRFKSTPTEDVKTGAPHDLYETDKKWALFFIPN 249
            .||.::..:..|...|:.|.|..|.|..||  ....:...|.:....|...|....    ...|.
  Fly   211 SSCIWKGINTRCESLFQRIDTMEGQCCTFNYFGGISNNFPEKIAYQVPKRPYRVTG----CGYPT 271

  Fly   250 STSRIFIFSNEEYFGSDF-------------NAQIDWSEPQLVE------VRISKKNTYTTDDAR 295
            ..|.:......:|:|:.|             |...:.||.::|.      |||:.::||.|:|.|
  Fly   272 GLSVLLNPMISDYYGTFFSGFGFRLLLHDAYNFPDENSETKVVTTTRESFVRINPESTYATNDIR 336

  Fly   296 QLSIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKCNPPF------YK--PIRELSC 352
            ::.:..|.|:|..|:.::.. ..|:|.:||.:||:...:.||.|.||:      ||  .:.:.:|
  Fly   337 RMDLSLRNCLFGSEMTMHGL-RRYSFINCMFECRVRMTVDLCGCLPPYVYNNGSYKVCGVLQTNC 400

  Fly   353 VIN---IFTNLIAYILLLYLTPKANVPMCSIKDFD-----CLDEFKSN---ITNIKDCLQCELSC 406
            :|:   :|::.:|.:         |..:..:::.|     ||.:.:||   ..:....|......
  Fly   401 IIHSKRLFSHALANL---------NFSLSIVRETDSFPCGCLPDCQSNHYVSESTTGRLDISYFA 456

  Fly   407 SKTVFNIDKLIKMSDRPESLGVLVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGV 471
            ::..||     ..:||   :.:.|.|......||:.::...|:..|.||||:..|.:|||:::..
  Fly   457 NRPTFN-----NATDR---ILLHVFFSDLMSTRYRTDIFQNWLSALASFGGLLGLIMGFSIVTAF 513

  Fly   472 EIIYYFTLRACCMVYKNRQ 490
            |.||:.|.|. ...|.||:
  Fly   514 EFIYFLTFRP-VFNYINRE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 111/496 (22%)
ppk16NP_001334673.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.