DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and ppk29

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:469 Identity:108/469 - (23%)
Similarity:181/469 - (38%) Gaps:107/469 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MWFCFTSIGAVTALVIIMSLWEKFQTNPTITGLDTDFHNQNVVFPTTVVC--PEAAFDHDKTYEK 120
            :|.....|...:.:.|::.|..:::|:.|..|:.|.:......||:..:|  ...||:..|...:
  Fly    23 LWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINTFPSIGICLTKSRAFNEFKAMMR 87

  Fly   121 VYNTLANYDEAQAQMYTPFLRILTSLNFENV---RDAKVLSQSIPQNLLDAHTIREWAFEGHIDC 182
            .|     :.|..|..:|..:.....||..|:   ...|..|.....|:||   ||...|.  .:|
  Fly    88 EY-----FQEDFAFSFTRMIYEYAFLNPNNIFTKEPTKNTSYPYNFNILD---IRRKMFP--TNC 142

  Fly   183 KNVFVSCKYRDEDIPCCDH-FEPIYTEHGFCYAFNSRFKSTPTEDVKTGAPHDLYETDKKWALFF 246
            ...|....:|.|.:..|:. |:...||.|:|:..|:.......|::    |......|.      
  Fly   143 TECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDSIEEM----PLRYSSLDN------ 197

  Fly   247 IPNSTSRIFIFSNEEYFGSDFNAQIDWSEPQLVEVRISKKNTYTTDDARQL-------------- 297
              |.:.|:::.|:..|     ..::..:.|:.:....|...|.:||.....              
  Fly   198 --NRSLRLYMRSSVMY-----KYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVID 255

  Fly   298 -SIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKC---NPPFYKPIRELSCVINIFT 358
             .|.||||.|..|..:..||  |:||:||...|....:|.|.|   ||   |...|         
  Fly   256 EPISQRKCKFPSESSIEGFP--YSFSACMSIIRSEFEMKTCDCSLFNP---KDRNE--------- 306

  Fly   359 NLIAYILLLYLTPKANVPMCSIKDFDCL--DEFKSNITN--------IKDCLQCELSC------S 407
                   .||         |.::..|||  :.|.:.:..        :..|::.::|.      :
  Fly   307 -------SLY---------CGLQHADCLIKEGFATRVKEYVGSSTVCLPSCVEQQISLVGVITEN 355

  Fly   408 KTVFNIDKLIKMSDRPESLGVLVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVE 472
            .|::|.:..|          ..::..:.|.:||:|:|....:||:|..|.:|.||.|.|||:.:|
  Fly   356 GTLYNNNTQI----------TEIQIASPPTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLE 410

  Fly   473 IIYYFTLRACCMVY 486
            ||.||..:...|::
  Fly   411 IISYFIKKLKTMIF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 105/457 (23%)
ppk29NP_001097442.2 ASC 123..415 CDD:279230 83/353 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.