DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and egas-3

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:339 Identity:65/339 - (19%)
Similarity:111/339 - (32%) Gaps:128/339 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GFCYAFNSR-------------------FKSTPTEDVKTGAPHDLYETDKKWALFFIPNSTSRIF 255
            |.|:.||.|                   |..|..::.   ||  .|:|           :...:|
 Worm   649 GNCFTFNHRDRNFTYLMRRPGRHGGIQAFMKTRQDEY---AP--WYDT-----------AAINVF 697

  Fly   256 IFSNEEYFGSD---FNAQIDWSEPQLVEVRISKKNTYTTDDARQLSIGQRKCIFS-DEVKLNYFP 316
            |.:.::|..|:   :|||.:..         |..|.:.|...| |.....|||.. .|||..|:|
 Worm   698 IHNRDDYVFSESVRYNAQPNAQ---------STINIFMTRYTR-LGGNYGKCIKKPSEVKNYYYP 752

  Fly   317 DAYTFSSCMKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKA-NVPMCSI 380
            .|||...|::.|..::..:.|.|..|.|                          |:| |...|.:
 Worm   753 GAYTTDGCLRTCYQDRMKEECNCMDPRY--------------------------PQAPNSTSCQL 791

  Fly   381 KDFDCL---DEFKSNITNIKDCLQCELSCSKTVFNI--DKLIKMSDRPESLGVLVEFLTWPII-- 438
            .:..|:   .|...:.:....|: |.|.||...:::  .|              ..|:..||.  
 Worm   792 SERSCVTEASEAAGDPSTWSSCV-CPLPCSNQEYSVTWSK--------------ANFVNLPITCE 841

  Fly   439 ----------RYKREVLFGWV------------------DLLVSFGGIASLFLGFSLLSGVEIIY 475
                      :||.:::...:                  ..|...||...:.:|.::::.:|:::
 Worm   842 KSSDVATCQKQYKDQLMVSIILPQLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVF 906

  Fly   476 YF--TLRACCMVYK 487
            .|  .....|..|:
 Worm   907 LFFGMFMVLCQKYE 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 62/324 (19%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 62/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.