DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and egas-1

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:318 Identity:70/318 - (22%)
Similarity:121/318 - (38%) Gaps:87/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GFCYAFNSRFKSTPTEDVKTGAPHDLYETDKK--------WALFFIPNSTSRIFIFSNEEYFGSD 266
            |.|:.||.|.::. |..:::...|...:...|        |    ...:...:||.:.::|..|:
 Worm   649 GNCFTFNHRDRNF-TYRLRSSGRHGGIQAFMKTRQDEYAPW----YDTAAINVFIHNRDDYVFSE 708

  Fly   267 ---FNAQIDWSEPQLVEVRISKKNTYTTDDARQLSIGQR--KCIFS-DEVKLNYFPDAYTFSSCM 325
               :|||.:..         |..|.:.|   |...:|.|  ||:.. .|||..|:|.|||...|:
 Worm   709 SVRYNAQPNAQ---------STMNIFMT---RYTRLGGRYGKCVKKPSEVKNYYYPGAYTTDGCL 761

  Fly   326 KQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKA--NVPMCSIKDFDCL-- 386
            :.|..::..:.|.|..|.|                          |:|  ||..|.:.:..|:  
 Worm   762 RTCYQDRMKQECNCMDPRY--------------------------PQAPGNVTSCQLSERSCVTV 800

  Fly   387 -DEFKSNITNIKDCLQCELSCSKTVFNID---------KLI--KMSD----RPESLGVLVEFLTW 435
             .|...:.:...||: |.|.||...:::.         .:|  |.||    :...:..|:..:..
 Worm   801 ASEAAGDPSKWWDCV-CPLPCSNQEYSVTWSKANFVNLPIICGKSSDVSTCKAHYIDQLMVSIVL 864

  Fly   436 PIIRYK---REVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIY----YFTLRACCMVY 486
            |.:.:|   ......:...|...||...:.:|.:|::.:|:::    .|||  ||..|
 Worm   865 PQLDFKIYAENPAMDFNKFLSQLGGQLGVLMGINLVTFIEVVFLLFGLFTL--CCKKY 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 64/306 (21%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309 64/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.