DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk23 and LOC103910008

DIOPT Version :9

Sequence 1:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster
Sequence 2:XP_009296668.1 Gene:LOC103910008 / 103910008 -ID:- Length:99 Species:Danio rerio


Alignment Length:120 Identity:28/120 - (23%)
Similarity:48/120 - (40%) Gaps:36/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 LFLGFSLLSGVEIIYYFTLRACCMVY---KNRQELYEIEEKIRQEPPPKIDLKLSLKSHNPRIGD 522
            ||:|.|:|:.:||:.|        ||   |:|     :|..:|   |.:.|.|.:.:........
Zfish     3 LFIGASVLTILEILDY--------VYEVIKHR-----LERLLR---PQRDDKKQTQQQQQASTVA 51

  Fly   523 TPTSAVLKVKPAEESAGPNPLGGYQRKHEKDYSLNTKNYYKTPKVVPDYGYTSKT 577
            |.....:|.|.:.|.:         |.|.:....||        |:|::.:..:|
Zfish    52 TVNLEEMKAKDSSEMS---------RSHSEGAYANT--------VLPNHHHHHRT 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk23NP_001097011.1 ASC 34..476 CDD:279230 7/14 (50%)
LOC103910008XP_009296668.1 ASC <1..32 CDD:295594 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.