DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5613 and AT3G61010

DIOPT Version :9

Sequence 1:NP_573215.1 Gene:CG5613 / 32726 FlyBaseID:FBgn0030839 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001319810.1 Gene:AT3G61010 / 825272 AraportID:AT3G61010 Length:427 Species:Arabidopsis thaliana


Alignment Length:180 Identity:40/180 - (22%)
Similarity:66/180 - (36%) Gaps:60/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 LIAKNGFSAGIFAPGWTFETLNRFGYNIKNPRGDDQVNASFLARNEAWWSRIWPT---LATHPYT 426
            |:.:|..||.:|||||.:||..:..:|              .|:|: |||.:..:   :.|...:
plant     5 LLKRNNVSAAMFAPGWVYETAQQPNFN--------------SAQNK-WWSLVEKSCGIVQTIHKS 54

  Fly   427 SLPFFTDFCVGSGRAKFER--------GWRILGEDSPFFNLSRQSLQPSVPLGRN-------AMH 476
            ||  ||...:.:....|..        .:..:....|......|||||.:.|..:       .:.
plant    55 SL--FTRISIRALVTMFHSKVSNSQIVAFSFILHRCPMVQHFCQSLQPLLELNEDNKDVIQATLD 117

  Fly   477 HFDEAYSGGCSLLVTNYERAFRLFVTDFELDRGVLLLRYVFKIDGDAVGT 526
            ..:.:::||                 |:...||        |::|||..|
plant   118 TREASFNGG-----------------DYITFRG--------KLEGDAYFT 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5613NP_573215.1 GH85_ENGase 144..476 CDD:119364 30/128 (23%)
AT3G61010NP_001319810.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I1109
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D722800at2759
OrthoFinder 1 1.000 - - FOG0005197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3708
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.