DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and LBX2

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens


Alignment Length:113 Identity:43/113 - (38%)
Similarity:58/113 - (51%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVG 361
            :|:||:|||||..|:..||:.|..||||:..||..||.:|.|::.||.||:||||.|.||...  
Human    83 RKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVE-- 145

  Fly   362 LELLAEAGNFAAFQ-------RLYGGSPYLGAWPYAAAAGAAHGATPH 402
             |:.|:..:..|..       .|..|:|.    |......|...:.||
Human   146 -EMRADVASLRALSPEVLCSLALPEGAPD----PGLCLGPAGPDSRPH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 30/55 (55%)
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 3/5 (60%)
Homeodomain 86..142 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.