DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB18

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:118 Identity:35/118 - (29%)
Similarity:58/118 - (49%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SGNMDDHSVCSNGGKDDDGNSVKS---------GST-----SDMSGLSKKQRKARTAFTDHQLQT 313
            |.::.||    :|.:|.|.|....         |:|     .|.:...::::|.|  .|..|...
plant    22 SPSLGDH----HGMRDFDINQTPKTEEDREWMIGATPHVNEDDSNSGGRRRKKLR--LTKEQSHL 80

  Fly   314 LEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK-RQTAVGLELL 365
            ||:||.:...|:.:::::||..|.||..||:.|:||||.:.| :.|.:..|.|
plant    81 LEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 22/56 (39%)
HB18NP_177248.3 HOX 66..122 CDD:197696 21/57 (37%)
HALZ 124..167 CDD:128634 3/10 (30%)

Return to query results.
Submit another query.