DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and ATHB13

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:98 Identity:32/98 - (32%)
Similarity:48/98 - (48%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 DCDSGNMDDHSVCSNGGKD--DDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQK 322
            |.::||.      .||.:|  |||           |.:.:|:|:...    .|::||||:||...
plant    62 DLETGNN------MNGEEDYSDDG-----------SQMGEKKRRLNM----EQVKTLEKNFELGN 105

  Fly   323 YLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
            .|..:.:.:||..|.|...|:..|:||||.:||
plant   106 KLEPERKMQLARALGLQPRQIAIWFQNRRARWK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 21/56 (38%)
ATHB13NP_177136.1 Homeodomain 85..138 CDD:459649 20/56 (36%)
HALZ 140..181 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.