DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HAT2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_199548.1 Gene:HAT2 / 834784 AraportID:AT5G47370 Length:283 Species:Arabidopsis thaliana


Alignment Length:235 Identity:55/235 - (23%)
Similarity:97/235 - (41%) Gaps:62/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LPSALHHPQPHPPTHPHTHPHALMH------PHGKLGHFPPTAGGNGLNVAQYAAAMQQHYAAAA 201
            |..:|...|.|.|...:.:|::.:.      |..:.  |.||:....::|..:.:.:.   ....
plant    10 LSLSLGFSQNHNPLQMNLNPNSSLSNNLQRLPWNQT--FDPTSDLRKIDVNSFPSTVN---CEED 69

  Fly   202 AAAAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEE---NEDCDS 263
            ...::.|:..::..:...:...|::..        |||           |.|.|:|   :.....
plant    70 TGVSSPNSTISSTISGKRSEREGISGT--------GVG-----------SGDDHDEITPDRGYSR 115

  Fly   264 GNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQR--KARTAFTDHQLQTLEKSFERQKYLSV 326
            |..|:         ::||     |.||     .||.|  |.::||       ||::|:....|:.
plant   116 GTSDE---------EEDG-----GETS-----RKKLRLSKDQSAF-------LEETFKEHNTLNP 154

  Fly   327 QERQELAHKLDLSDCQVKTWYQNRRTKWK-RQTAVGLELL 365
            :::..||.||:|:..||:.|:||||.:.| :||.|..|.|
plant   155 KQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 18/51 (35%)
HAT2NP_199548.1 HD-ZIP_N 8..91 CDD:398351 12/85 (14%)
HOX 129..183 CDD:197696 22/60 (37%)
HALZ 185..228 CDD:128634 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.