DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB16

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:82 Identity:31/82 - (37%)
Similarity:49/82 - (59%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 GKDDDGNSVK--SGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDL 338
            |.|:|...::  ||:...| |||:|:|:.:.    .|::.|||:||.:..|..:.:.:||.:|.|
plant    36 GYDEDATLIEEYSGNHHHM-GLSEKKRRLKV----DQVKALEKNFELENKLEPERKTKLAQELGL 95

  Fly   339 SDCQVKTWYQNRRTKWK 355
            ...||..|:||||.:||
plant    96 QPRQVAVWFQNRRARWK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 21/56 (38%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 20/56 (36%)
HALZ 114..155 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.