DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HAT1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:166 Identity:42/166 - (25%)
Similarity:65/166 - (39%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PAGGDLDDSSDYHEENEDCDS-----GNMDDHSVCSNGGKDDD-----GNSVKSGSTSDMSGLSK 297
            |...||::.:.....|....|     ....:....|.||..||     ..|...|::.:......
plant    66 PTTVDLEEETGVSSPNSTISSTVSGKRRSTEREGTSGGGCGDDLDITLDRSSSRGTSDEEEDYGG 130

  Fly   298 KQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK-RQTAVG 361
            :..:.:...:..|...||.:|:....|:.:::..||.||.|:..||:.|:||||.:.| :||.|.
plant   131 ETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEVD 195

  Fly   362 LELL---------------AEAGNFAAFQ---RLYG 379
            .|.|               .||....|.:   ||||
plant   196 CEYLKRCVEKLTEENRRLEKEAAELRALKLSPRLYG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 17/51 (33%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 5/31 (16%)
HOX 134..188 CDD:197696 17/53 (32%)
HALZ 190..233 CDD:128634 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.