DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB-12

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:74 Identity:23/74 - (31%)
Similarity:43/74 - (58%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 NSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTW 346
            :.:.||.|.:...:.|...:.|  |::.|:::||..||.:..|..:::.::|.:|.|...||..|
plant    12 SEISSGMTMNKKKMKKSNNQKR--FSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIW 74

  Fly   347 YQNRRTKWK 355
            :||:|.:||
plant    75 FQNKRARWK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 19/56 (34%)
HB-12NP_191748.1 Homeodomain 33..83 CDD:459649 17/51 (33%)
HALZ 85..126 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.