DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB20

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:120 Identity:33/120 - (27%)
Similarity:51/120 - (42%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 HEENEDCDSGNMDDHSVCSNGG--------------KDDDGNSVKSGSTSD-----MSGLSKKQR 300
            ||:|......:...|  ..|||              ::|...::...:.||     |.|..||:.
plant    29 HEDNSQDQLPSCPPH--LFNGGGNYMMNRSMSLMNVQEDHNQTLDEENLSDDGAHTMLGEKKKRL 91

  Fly   301 KARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
            :.      .|::.||||||....|..:.:.:||..|.:...|:..|:||||.:||
plant    92 QL------EQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 19/56 (34%)
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 19/58 (33%)
HALZ 142..183 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.