powered by:
Protein Alignment B-H1 and HB-7
DIOPT Version :9
Sequence 1: | NP_523387.1 |
Gene: | B-H1 / 32724 |
FlyBaseID: | FBgn0011758 |
Length: | 544 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_182191.1 |
Gene: | HB-7 / 819280 |
AraportID: | AT2G46680 |
Length: | 258 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 23/65 - (35%) |
Similarity: | 39/65 - (60%) |
Gaps: | 6/65 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 297 KKQRKA------RTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWK 355
||.:|: :..|:|.|:::||..||.:..|..:::.:||.:|.|...||..|:||:|.:||
plant 21 KKMKKSNHNKNNQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWK 85
Fly 356 355
plant 86 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
B-H1 | NP_523387.1 |
Homeobox |
303..355 |
CDD:278475 |
18/51 (35%) |
HB-7 | NP_182191.1 |
Homeobox |
35..85 |
CDD:395001 |
18/49 (37%) |
HALZ |
87..126 |
CDD:396657 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.