DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB22

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_850266.1 Gene:HB22 / 818233 AraportID:AT2G36610 Length:185 Species:Arabidopsis thaliana


Alignment Length:127 Identity:38/127 - (29%)
Similarity:62/127 - (48%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 NEDCDSGNMDDHSVCSNGGKDDD-----GNSVKSG---STSDMSGLSKKQRKARTAFTDHQLQTL 314
            |.|..|||.|:..:.:..|...|     ...|:||   .::..:|..||::|    .|..||:.|
plant    23 NFDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESGYGEESNSFNGQEKKKKK----MTSEQLKFL 83

  Fly   315 EKSF--------ERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEA 368
            |:||        :|:..|:...:.:|:.:|.|...|:..|:|||:.:||.:.   ||.|.|:
plant    84 ERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKNKQ---LEHLYES 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 19/63 (30%)
HB22NP_850266.1 Homeodomain 70..133 CDD:459649 21/66 (32%)
HALZ 134..167 CDD:460477 4/12 (33%)

Return to query results.
Submit another query.