DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB21

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:117 Identity:33/117 - (28%)
Similarity:50/117 - (42%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 NMDDHS---------------VCSNGGKDDDGNSVKSGSTS---------DMSGLSKKQRKARTA 305
            |:|||:               |...||:.......|..|.|         :.:|..:|::     
plant     5 NVDDHNLLLISQLYPNVYTPLVPQQGGEAKPTRRRKRKSKSVVVAEEGENEGNGWFRKRK----- 64

  Fly   306 FTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQ 357
            .:|.|::.||.|||....|..:.:..||.:|.|...||..|:||||.:||.:
plant    65 LSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 19/51 (37%)
HB21NP_179445.1 HOX 61..114 CDD:197696 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.