DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and HB17

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:249 Identity:56/249 - (22%)
Similarity:89/249 - (35%) Gaps:90/249 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 SNGGKDD---DGNSVKSGSTSD------MSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQE 328
            |.||:|.   |.|.:.|....|      ..|.:..::|.|  .|..|.:.||.||.:...|:.::
plant   103 SGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLR--LTREQSRLLEDSFRQNHTLNPKQ 165

  Fly   329 RQELAHKLDLSDCQVKTWYQNRRTKWK-RQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAA 392
            ::.||..|.|...|::.|:||||.:.| :||.:..|                   ||..|     
plant   166 KEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECE-------------------YLKRW----- 206

  Fly   393 AGAAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSS 457
                .|:....|..: :|:.....||:                     |||   :.::::|||:.
plant   207 ----FGSLTEENHRL-HREVEELRAMK---------------------VGP---TTVNSASSLTM 242

  Fly   458 LSSYYQSAAAAASAANPGGPHPVAPPPSVGGGSPPSGLVKPIPAHSASASPPPR 511
            .....:...||:                      ||..|.|:||....   ||:
plant   243 CPRCERVTPAAS----------------------PSRAVVPVPAKKTF---PPQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 18/51 (35%)
HB17NP_178252.2 HOX 136..192 CDD:197696 19/57 (33%)
HALZ 194..237 CDD:128634 14/95 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.