DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and NANOG

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:106 Identity:41/106 - (38%)
Similarity:55/106 - (51%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 HEENEDCDSGNMD----DHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLE 315
            |.|.......:||    |....|...|.....|.:.........:..|::|.||.|:..||..|.
Human    47 HTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLN 111

  Fly   316 KSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR 356
            ..|:||||||:|:.|||::.|:||..|||||:||:|.|.||
Human   112 DRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 30/55 (55%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 9/48 (19%)
COG5576 74..191 CDD:227863 34/79 (43%)
Homeodomain 97..152 CDD:459649 30/54 (56%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 16/28 (57%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.