DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Hhex

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_077361.1 Gene:Hhex / 79237 RGDID:619932 Length:271 Species:Rattus norvegicus


Alignment Length:59 Identity:32/59 - (54%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR 356
            |::..:..|::.|...|||.||.|||||..||:.||..|.||:.|||||:||||.||:|
  Rat   137 KRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 30/55 (55%)
HhexNP_077361.1 Homeodomain 137..195 CDD:459649 31/57 (54%)

Return to query results.
Submit another query.