DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and lbx1

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:60 Identity:35/60 - (58%)
Similarity:46/60 - (76%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKR 356
            ||:||:|||||:||:..|||.|..|||||..:|.::|.:|.|::.||.||:||||.|.||
 Frog   123 KKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 31/55 (56%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Homeodomain 126..182 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.