DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Nanog

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:165 Identity:50/165 - (30%)
Similarity:78/165 - (47%) Gaps:41/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 VGL----APPAGGDLDDSSD-------YHEENEDCDSGNMDDHSVCSNG-------------GKD 278
            |||    :.|:..:..:|.:       :|.||..|..|:..: .:|:..             |..
Mouse     3 VGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATE-MLCTEAASPRPSSEDLPLQGSP 66

  Fly   279 DDGNSVK---------SGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAH 334
            |...|.|         .|...:.:.:..:::|.||.|:..||..|:..|::|||||:|:.|||:.
Mouse    67 DSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSS 131

  Fly   335 KLDLSDCQVKTWYQNRRTKWKR-------QTAVGL 362
            .|:||..|||||:||:|.|.||       :|:.||
Mouse   132 ILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 29/55 (53%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 6/48 (13%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 31/58 (53%)
Homeodomain 98..153 CDD:459649 29/54 (54%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 16/28 (57%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.