DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and Barx2

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:316 Identity:87/316 - (27%)
Similarity:112/316 - (35%) Gaps:119/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HSTTTMSSGGSTTTASGIGKPNRSRFMINDILAGSAAAAFYKQQQHHQQLHHHNNNNNSGSSGGS 116
            |:...:||.|....|    :.....|||::||:......|.|...:                   
  Rat     4 HAELRLSSPGQLKAA----RRRYKTFMIDEILSKETCDYFEKLSLY------------------- 45

  Fly   117 SPAHSNNNNNINGDNCEASNVAGVGVLPSALHHPQP-HPPT-HPHTHPHALMHPHGK----LGHF 175
                                    .|.||.:..|:| |..| .|....:.|:....:    :.|.
  Rat    46 ------------------------SVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPTVISHL 86

  Fly   176 PPTAGGNGLNVAQYAAAMQQHYAAAAAAAAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGL 240
            .||  |.||.......|:                ||.|||||||||||..|..|      ||..|
  Rat    87 VPT--GPGLTPVNTRHAV----------------AAEAAAAAAAAAAAAAAETP------GGEAL 127

  Fly   241 APPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTA 305
            |         ||:                                 ..|...:...||.|::||.
  Rat   128 A---------SSE---------------------------------SETEQPTPRQKKPRRSRTI 150

  Fly   306 FTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVG 361
            ||:.||..|||.|::|||||..:|.:||..|.|:..||||||||||.|||:....|
  Rat   151 FTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 31/51 (61%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.