DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and BARX1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_067545.3 Gene:BARX1 / 56033 HGNCID:955 Length:254 Species:Homo sapiens


Alignment Length:220 Identity:70/220 - (31%)
Similarity:87/220 - (39%) Gaps:51/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PPT-----HPHTH-----PHALMHPHGKLGHFPPTAGGN-------GLNVAQYAAAMQQHYAAAA 201
            ||.     .||.:     ...|..|.|..|..|..|...       |:.....|.....|.|...
Human    14 PPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLK 78

  Fly   202 AAAAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNM 266
            |..||......|....:..::|.:||.|   |:.|..| ||            |...|....|.:
Human    79 AEQAAVFKFPLAPLGCSGLSSALLAAGP---GLPGAAG-AP------------HLPLELQLRGKL 127

  Fly   267 DDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQE 331
            :      ..|..:.|...|.|            |::||.||:.||..|||.||:|||||..:|.:
Human   128 E------AAGPGEPGTKAKKG------------RRSRTVFTELQLMGLEKRFEKQKYLSTPDRID 174

  Fly   332 LAHKLDLSDCQVKTWYQNRRTKWKR 356
            ||..|.||..||||||||||.|||:
Human   175 LAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 33/51 (65%)
BARX1NP_067545.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 2/5 (40%)
Homeobox 145..199 CDD:395001 34/53 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.