DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and barx1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:135 Identity:53/135 - (39%)
Similarity:67/135 - (49%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 AAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKS 286
            :..:.||.....:.|..||..       .||.:|..        :|.|.    .||.|.|     
Zfish    85 SCSLGAPLSSALLSGAAGLQV-------GSSSHHLP--------LDLHL----RGKLDPG----- 125

  Fly   287 GSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRR 351
               :|....:||.|::||.||:.||..|||.||:|||||..:|.:||..|.||..||||||||||
Zfish   126 ---ADAVSKTKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRR 187

  Fly   352 TKWKR 356
            .|||:
Zfish   188 MKWKK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 33/51 (65%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.