DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and npm1b

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_005173145.2 Gene:npm1b / 553507 ZFINID:ZDB-GENE-080723-7 Length:316 Species:Danio rerio


Alignment Length:168 Identity:37/168 - (22%)
Similarity:53/168 - (31%) Gaps:68/168 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 GGVGLAPP------AGG--------------DLDDSSDYHEEN---------------------- 258
            ||..:.||      :||              :.||..:..|||                      
Zfish   105 GGFEVTPPVSFRLQSGGGPVYISGQHFVSVKESDDEDEEEEENNTSPVKRPSNMTLAKVPQKKLK 169

  Fly   259 ------EDCDSGNMDDHSVCSNGGKDDDGN---SVKSGSTSDMSGLSKKQ----------RKART 304
                  ||.|..:.||.....:..:|||..   :|||...|......||:          :||.|
Zfish   170 MDSDEDEDSDDDDDDDDDDDDDEEEDDDKQEKPAVKSPVKSTQKTPEKKKSADKQNGSPDKKAGT 234

  Fly   305 AFTDHQLQTLEKSFERQ------KYLSVQERQELAHKL 336
            : ...|.||.:|..::.      |..|:....|:..||
Zfish   235 S-GKPQTQTPQKVKDKSAAGPSGKTPSIPSLSEVKSKL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 10/40 (25%)
npm1bXP_005173145.2 Nucleoplasmin 32..131 CDD:308605 6/25 (24%)
NPM1-C 265..313 CDD:318505 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.