DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and barhl1a

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:311 Identity:112/311 - (36%)
Similarity:131/311 - (42%) Gaps:124/311 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 AAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMDDHSVCSNGGKDD 279
            ||.|..::.|.:|.                  |.:|..|....|...||    ::.|     ||:
Zfish    99 AACAPYSSTGQSAQ------------------DAEDCMDKLHSNSSSDS----EYRV-----KDE 136

  Fly   280 DGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVK 344
            ....:.|...|..|.| ||.||||||||||||..||:|||||||||||:|.|||..|:|:|.|||
Zfish   137 ADREISSSRDSPNSRL-KKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVK 200

  Fly   345 TWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYY 409
            ||||||||||||||||||||||||||::|.||:: .|||                        :|
Zfish   201 TWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMF-PSPY------------------------FY 240

  Fly   410 RQAAAAAAMQKPLPYNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLSSYYQSAAAAASAANP 474
            .|:..:.....|..| ||.|                                             
Zfish   241 PQSLVSNLDPGPGLY-LYRG--------------------------------------------- 259

  Fly   475 GGPHPVAPPPSV--------------GGGSPPSGLVKPIPAHSASASPPPR 511
                |.||||.|              |||.|.| |...||.|      |||
Zfish   260 ----PSAPPPPVQRPLVPRILLHGLQGGGDPAS-LSGVIPRH------PPR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 41/51 (80%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 29/64 (45%)
Homeobox 159..211 CDD:278475 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575742
Domainoid 1 1.000 103 1.000 Domainoid score I6717
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4314
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002353
OrthoInspector 1 1.000 - - mtm6505
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10747
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.