DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and NKX1-1

DIOPT Version :9

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001277008.1 Gene:NKX1-1 / 54729 HGNCID:24975 Length:448 Species:Homo sapiens


Alignment Length:474 Identity:124/474 - (26%)
Similarity:160/474 - (33%) Gaps:158/474 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ASNVAGVGVLPSALHHPQ----PHPPTHPHTHPHALMHPHGKLGHF-----PPTAGGN------- 182
            ||.....|.:|:....||    |.||. |.......|....:|..|     ||.|..:       
Human     3 ASGPEAPGDIPALPPPPQPGSGPAPPA-PAAAAQEAMDGRAELPAFPRAGAPPLAASDTVPAAPE 66

  Fly   183 GLNVAQYAAAMQQ-------------------------HYAAAAAAAAARNNAAAAAAAA----- 217
            |...|:.||.::.                         ..|.||.|..|....|.|.||:     
Human    67 GAGAARPAAPLRPTSFSVLDILDPNKFNSRRRRCVLLGPVAPAACAPCASAPCAPAPAASGRPPR 131

  Fly   218 -------AAAAAAGVAA----PP---------------VDGGVDGGVGLAPPA-GGD--LDDSSD 253
                   |.|.|.||.|    ||               .:|...||.|.:|.| .||  .||..|
Human   132 AEELERRALAGAGGVGAAGAEPPNAGDPFKAGEAETNDTNGYSSGGGGHSPSADSGDEVPDDEDD 196

  Fly   254 YHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMS------------------------- 293
            ..:|..:.::....:.:....||....|:..:..:.:|.|                         
Human   197 DEDEAPETEAARGAEEARGGGGGLGARGSGCQGAAETDASPGATVDEAAAPGPRENSPVAQGPPG 261

  Fly   294 -----------------------------GLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQER 329
                                         ..|.|.|:||||||..||..||..|:..:||||.||
Human   262 GAAAPGGAGTTPQGTATAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCER 326

  Fly   330 QELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNFAAFQRLYGGSPYLGAWPYAAAAG 394
            ..||..|.|::.|||.|:||||||||:|.. |.:..|..|.        ||.|..||.|   ..|
Human   327 LNLALSLSLTETQVKIWFQNRRTKWKKQNP-GADTSAPTGG--------GGGPGPGAGP---GTG 379

  Fly   395 AAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVGVGVGVGVGPAPFSHLSASSSLSSLS 459
            ...|.:|          .:.:..|..||..:..||.|:.|.|..|.....||  ||:.:.||...
Human   380 LPGGLSP----------LSPSPPMGAPLGMHGPAGYPAHGPGGLVCAAQLPF--LSSPAVLSPFV 432

  Fly   460 SYYQSAAAAASAANPGGPH 478
            ...|:..|.|..|    ||
Human   433 LGSQTYGAPAFYA----PH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 30/51 (59%)
NKX1-1NP_001277008.1 Homeobox 300..352 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.