DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H1 and nkx3.3

DIOPT Version :10

Sequence 1:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001013342.2 Gene:nkx3.3 / 503746 ZFINID:ZDB-GENE-050306-27 Length:240 Species:Danio rerio


Alignment Length:107 Identity:42/107 - (39%)
Similarity:60/107 - (56%) Gaps:4/107 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSDYHEENEDCDSGNMDDHSVCSNGGKDDDGNSVKSGSTSDMSGLSKKQRKARTAFTDHQLQTLE 315
            |||.|...|:...   :|:|:......:.|....:|.|..|.:..|.|:| :|.||:..|:..||
Zfish    67 SSDQHSCEEESTG---EDNSLERRHDHEMDQQKPQSCSFEDSNPKSSKKR-SRAAFSHAQVYELE 127

  Fly   316 KSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQ 357
            :.|..|:|||..||.:||..|.|::.|||.|:||||.|.||:
Zfish   128 RRFNLQRYLSGPERADLAGALKLTETQVKIWFQNRRYKTKRR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H1NP_523387.1 Homeodomain 300..356 CDD:459649 27/55 (49%)
nkx3.3NP_001013342.2 Homeodomain 112..168 CDD:459649 27/56 (48%)

Return to query results.
Submit another query.